PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_56769.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 323aa    MW: 36039.4 Da    PI: 7.6041
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_56769.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.66.7e-55241531129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                   +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL +     ++e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk+v++
  MLOC_56769.2  24 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLTEhcgIGYEEQSEWYFFSFKDRKYPTGTRTNRATMAGFWKATGRDKAVHE 119
                   69****************************.9***************853542334667*************************************9 PP

           NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    +++l+g++ktLvfykgrap+g+ktdW+mheyrle
  MLOC_56769.2 120 -RSRLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 153
                   .999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-6021173IPR003441NAC domain
PROSITE profilePS5100559.08124173IPR003441NAC domain
PfamPF023651.5E-2825152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MHIQPMRAGG GGGVDHMDSM ESCVPPGFRF HPTDEELVGY YLRKKVASQK IDLDVIRDID  60
LYRIEPWDLT EHCGIGYEEQ SEWYFFSFKD RKYPTGTRTN RATMAGFWKA TGRDKAVHER  120
SRLIGMRKTL VFYKGRAPNG QKTDWIMHEY RLETDENAPP QEEGWVVCRA FKKRTAYPNR  180
GMAERWGSNY SYNEVHAMGG APFADPNMAS TYAAAAQMGR SGSFKEEAEQ LDGAAALLRY  240
TSSHLVELPQ LESPSAPLPR KKARAPEEED AASGASRRRP RKLAQADSAA TTDWRALDKF  300
VASQLSPGGE CAALEATAAT TAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-512117712172Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1276281RRRPRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934220.0JQ693422.1 Brachypodium distachyon SWN1 (SWN1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985886.11e-161PREDICTED: NAC domain-containing protein 37-like
SwissprotQ9SL411e-125NAC37_ARATH; NAC domain-containing protein 37
TrEMBLM0X3P80.0M0X3P8_HORVD; Uncharacterized protein
STRINGMLOC_56769.10.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-125vascular related NAC-domain protein 1